Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) |
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) |
Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [54345] (20 PDB entries) Uniprot P23313 |
Domain d1sjed2: 1sje D:122-239 [105645] Other proteins in same PDB: d1sjea1, d1sjea2, d1sjeb1, d1sjeb2, d1sjed1 |
PDB Entry: 1sje (more details), 2.45 Å
SCOPe Domain Sequences for d1sjed2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sjed2 d.15.6.1 (D:122-239) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]} hfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspy etgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng
Timeline for d1sjed2:
View in 3D Domains from other chains: (mouse over for more information) d1sjea1, d1sjea2, d1sjeb1, d1sjeb2 |