Lineage for d1sjed2 (1sje D:122-239)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2179689Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2179690Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 2179755Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species)
  7. 2179756Species Staphylococcus aureus [TaxId:1280] [54345] (20 PDB entries)
    Uniprot P23313
  8. 2179772Domain d1sjed2: 1sje D:122-239 [105645]
    Other proteins in same PDB: d1sjea1, d1sjea2, d1sjeb1, d1sjeb2, d1sjed1

Details for d1sjed2

PDB Entry: 1sje (more details), 2.45 Å

PDB Description: hla-dr1 complexed with a 16 residue hiv capsid peptide bound in a hairpin conformation
PDB Compounds: (D:) Enterotoxin type C-3

SCOPe Domain Sequences for d1sjed2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sjed2 d.15.6.1 (D:122-239) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
hfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspy
etgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng

SCOPe Domain Coordinates for d1sjed2:

Click to download the PDB-style file with coordinates for d1sjed2.
(The format of our PDB-style files is described here.)

Timeline for d1sjed2: