Lineage for d1sjed1 (1sje D:1-121)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558996Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 559069Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 559492Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (14 proteins)
  6. 559538Protein Staphylococcal enterotoxin C3, SEC3 [50228] (1 species)
  7. 559539Species Staphylococcus aureus [TaxId:1280] [50229] (10 PDB entries)
  8. 559545Domain d1sjed1: 1sje D:1-121 [105644]
    Other proteins in same PDB: d1sjea1, d1sjea2, d1sjeb1, d1sjeb2, d1sjed2
    mutant

Details for d1sjed1

PDB Entry: 1sje (more details), 2.45 Å

PDB Description: hla-dr1 complexed with a 16 residue hiv capsid peptide bound in a hairpin conformation

SCOP Domain Sequences for d1sjed1:

Sequence, based on SEQRES records: (download)

>d1sjed1 b.40.2.2 (D:1-121) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdsffkwdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvgkvtggktcmyggitkheg
n

Sequence, based on observed residues (ATOM records): (download)

>d1sjed1 b.40.2.2 (D:1-121) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdsffkwdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskggktcmyggitkhegn

SCOP Domain Coordinates for d1sjed1:

Click to download the PDB-style file with coordinates for d1sjed1.
(The format of our PDB-style files is described here.)

Timeline for d1sjed1: