![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class II MHC beta chain, N-terminal domain [88819] (15 species) |
![]() | Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88822] (13 PDB entries) Uniprot P04229 30-219 |
![]() | Domain d1sjeb2: 1sje B:1-92 [105643] Other proteins in same PDB: d1sjea1, d1sjea2, d1sjeb1, d1sjed1, d1sjed2 |
PDB Entry: 1sje (more details), 2.45 Å
SCOPe Domain Sequences for d1sjeb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sjeb2 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]} gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey wnsqkdlleqrraavdtycrhnygvgesftvq
Timeline for d1sjeb2:
![]() Domains from other chains: (mouse over for more information) d1sjea1, d1sjea2, d1sjed1, d1sjed2 |