SCOP 1.73: Domain d1sjeb2: 1sje B:1-92

Lineage for d1sjeb2 (1sje B:1-92)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)

7. Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88822] (12 PDB entries)

8. Domain d1sjeb2: 1sje B:1-92 [105643]
   Other proteins in same PDB: d1sjea1, d1sjea2, d1sjeb1, d1sjed1, d1sjed2
   mutant

Details for d1sjeb2

PDB Entry: 1sje, 2.45 Å

PDB Description: hla-dr1 complexed with a 16 residue hiv capsid peptide bound in a hairpin conformation

PDB Compounds: (B:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOP Domain Sequences for d1sjeb2:

Sequence; same for both SEQRES and ATOM records:

>d1sjeb2 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]}
gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
wnsqkdlleqrraavdtycrhnygvgesftvq

Timeline for d1sjeb2:

• d1sjeb2 first appeared in SCOP 1.69
  
• d1sjeb2 appears in SCOP 1.71
  
• d1sjeb2 appears in SCOP 1.75
  
• d1sjeb2 appears in the current release, SCOPe 2.08