Lineage for d1sjeb2 (1sje B:1-92)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88822] (13 PDB entries)
    Uniprot P04229 30-219
  8. Domain d1sjeb2: 1sje B:1-92 [105643]
    Other proteins in same PDB: d1sjea1, d1sjea2, d1sjeb1, d1sjed1, d1sjed2
    fragment; missing more than one-third of the common structure and/or sequence

Details for d1sjeb2

PDB Entry: 1sje (more details), 2.4499999999999997 Å

PDB Description: hla-dr1 complexed with a 16 residue hiv capsid peptide bound in a hairpin conformation
PDB Compounds: (B:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOPe Domain Sequences for d1sjeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sjeb2 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]}
gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
wnsqkdlleqrraavdtycrhnygvgesftvq

SCOPe Domain Coordinates for d1sjeb2 are not available.

Timeline for d1sjeb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sjeb1
View in 3D
Domains from other chains:
(mouse over for more information)
d1sjea1, d1sjea2, d1sjed1, d1sjed2