Lineage for d1sjeb2 (1sje B:1-92)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2938367Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 2938411Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88822] (13 PDB entries)
    Uniprot P04229 30-219
  8. 2938423Domain d1sjeb2: 1sje B:1-92 [105643]
    Other proteins in same PDB: d1sjea1, d1sjea2, d1sjeb1, d1sjed1, d1sjed2
    fragment; missing more than one-third of the common structure and/or sequence

Details for d1sjeb2

PDB Entry: 1sje (more details), 2.45 Å

PDB Description: hla-dr1 complexed with a 16 residue hiv capsid peptide bound in a hairpin conformation
PDB Compounds: (B:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOPe Domain Sequences for d1sjeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sjeb2 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]}
gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
wnsqkdlleqrraavdtycrhnygvgesftvq

SCOPe Domain Coordinates for d1sjeb2:

Click to download the PDB-style file with coordinates for d1sjeb2.
(The format of our PDB-style files is described here.)

Timeline for d1sjeb2: