| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
| Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
| Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (18 PDB entries) Uniprot P01903 28-207 |
| Domain d1sjea2: 1sje A:4-81 [105641] Other proteins in same PDB: d1sjea1, d1sjeb1, d1sjeb2, d1sjed1, d1sjed2 |
PDB Entry: 1sje (more details), 2.45 Å
SCOPe Domain Sequences for d1sjea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sjea2 d.19.1.1 (A:4-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani
avdkanleimtkrsnytp
Timeline for d1sjea2:
View in 3DDomains from other chains: (mouse over for more information) d1sjeb1, d1sjeb2, d1sjed1, d1sjed2 |