Lineage for d1sjea2 (1sje A:4-81)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501112Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 501113Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 501114Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 501366Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 501376Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (15 PDB entries)
  8. 501379Domain d1sjea2: 1sje A:4-81 [105641]
    Other proteins in same PDB: d1sjea1, d1sjeb1, d1sjeb2, d1sjed1, d1sjed2

Details for d1sjea2

PDB Entry: 1sje (more details), 2.45 Å

PDB Description: hla-dr1 complexed with a 16 residue hiv capsid peptide bound in a hairpin conformation

SCOP Domain Sequences for d1sjea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sjea2 d.19.1.1 (A:4-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1}
ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani
avdkanleimtkrsnytp

SCOP Domain Coordinates for d1sjea2:

Click to download the PDB-style file with coordinates for d1sjea2.
(The format of our PDB-style files is described here.)

Timeline for d1sjea2: