SCOP 1.69: Domain d1sjea2: 1sje A:4-81

Lineage for d1sjea2 (1sje A:4-81)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)

7. Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (15 PDB entries)

8. Domain d1sjea2: 1sje A:4-81 [105641]
   Other proteins in same PDB: d1sjea1, d1sjeb1, d1sjeb2, d1sjed1, d1sjed2

Details for d1sjea2

PDB Entry: 1sje, 2.45 Å

PDB Description: hla-dr1 complexed with a 16 residue hiv capsid peptide bound in a hairpin conformation

SCOP Domain Sequences for d1sjea2:

Sequence; same for both SEQRES and ATOM records:

>d1sjea2 d.19.1.1 (A:4-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1}
ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani
avdkanleimtkrsnytp

Timeline for d1sjea2:

• d1sjea2 is new in SCOP 1.69
  
• d1sjea2 appears in SCOP 1.71
  
• d1sjea2 appears in the current release, SCOPe 2.08