Lineage for d1sjdc1 (1sjd C:126-367)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 475826Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this family
  5. 475869Family c.1.11.2: D-glucarate dehydratase-like [51609] (9 proteins)
  6. 475954Protein N-acylamino acid racemase [110372] (2 species)
  7. 475955Species Amycolatopsis sp. [TaxId:37632] [110373] (4 PDB entries)
  8. 475958Domain d1sjdc1: 1sjd C:126-367 [105636]
    Other proteins in same PDB: d1sjda2, d1sjdb2, d1sjdc2, d1sjdd2

Details for d1sjdc1

PDB Entry: 1sjd (more details), 1.87 Å

PDB Description: x-ray structure of o-succinylbenzoate synthase complexed with n-succinyl phenylglycine

SCOP Domain Sequences for d1sjdc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sjdc1 c.1.11.2 (C:126-367) N-acylamino acid racemase {Amycolatopsis sp.}
vrdsvpcgvsvgimdtipqlldvvggyldegyvriklkiepgwdvepvravrerfgddvl
lqvdantaytlgdapqlarldpfglllieqpleeedvlghaelarriqtpicldesivsa
raaadaiklgavqivnikpgrvggylearrvhdvcaahgipvwcggmietglgraanval
aslpnftlpgdtsasdrfyktditepfvlsgghlpvptgpglgvapipelldevttakvw
ig

SCOP Domain Coordinates for d1sjdc1:

Click to download the PDB-style file with coordinates for d1sjdc1.
(The format of our PDB-style files is described here.)

Timeline for d1sjdc1: