Lineage for d1sjdb1 (1sjd B:126-368)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 817947Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 818012Family c.1.11.2: D-glucarate dehydratase-like [51609] (13 proteins)
  6. 818133Protein N-acylamino acid racemase [110372] (4 species)
  7. 818134Species Amycolatopsis sp. [TaxId:37632] [110373] (4 PDB entries)
    Uniprot Q44244 # similar activity to a remotely related O-succinylbenzoate synthase from E. coli
  8. 818136Domain d1sjdb1: 1sjd B:126-368 [105634]
    Other proteins in same PDB: d1sjda2, d1sjdb2, d1sjdc2, d1sjdd2

Details for d1sjdb1

PDB Entry: 1sjd (more details), 1.87 Å

PDB Description: x-ray structure of o-succinylbenzoate synthase complexed with n-succinyl phenylglycine
PDB Compounds: (B:) N-acylamino acid racemase

SCOP Domain Sequences for d1sjdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sjdb1 c.1.11.2 (B:126-368) N-acylamino acid racemase {Amycolatopsis sp. [TaxId: 37632]}
vrdsvpcgvsvgimdtipqlldvvggyldegyvriklkiepgwdvepvravrerfgddvl
lqvdantaytlgdapqlarldpfglllieqpleeedvlghaelarriqtpicldesivsa
raaadaiklgavqivnikpgrvggylearrvhdvcaahgipvwcggmietglgraanval
aslpnftlpgdtsasdrfyktditepfvlsgghlpvptgpglgvapipelldevttakvw
igs

SCOP Domain Coordinates for d1sjdb1:

Click to download the PDB-style file with coordinates for d1sjdb1.
(The format of our PDB-style files is described here.)

Timeline for d1sjdb1: