SCOP 1.69: Domain d1sjdb1: 1sjd B:126-368

Lineage for d1sjdb1 (1sjd B:126-368)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this family

5. Family c.1.11.2: D-glucarate dehydratase-like [51609] (9 proteins)

6. Protein N-acylamino acid racemase [110372] (2 species)

7. Species Amycolatopsis sp. [TaxId:37632] [110373] (4 PDB entries)

8. Domain d1sjdb1: 1sjd B:126-368 [105634]
   Other proteins in same PDB: d1sjda2, d1sjdb2, d1sjdc2, d1sjdd2

Details for d1sjdb1

PDB Entry: 1sjd, 1.87 Å

PDB Description: x-ray structure of o-succinylbenzoate synthase complexed with n-succinyl phenylglycine

SCOP Domain Sequences for d1sjdb1:

Sequence; same for both SEQRES and ATOM records:

>d1sjdb1 c.1.11.2 (B:126-368) N-acylamino acid racemase {Amycolatopsis sp.}
vrdsvpcgvsvgimdtipqlldvvggyldegyvriklkiepgwdvepvravrerfgddvl
lqvdantaytlgdapqlarldpfglllieqpleeedvlghaelarriqtpicldesivsa
raaadaiklgavqivnikpgrvggylearrvhdvcaahgipvwcggmietglgraanval
aslpnftlpgdtsasdrfyktditepfvlsgghlpvptgpglgvapipelldevttakvw
igs

Timeline for d1sjdb1:

• d1sjdb1 is new in SCOP 1.69
  
• d1sjdb1 appears in SCOP 1.71
  
• d1sjdb1 appears in the current release, SCOPe 2.08