Lineage for d1sjda2 (1sjd A:1-125)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203262Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1203263Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 1203264Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 1203446Protein N-acylamino acid racemase [110937] (4 species)
  7. 1203447Species Amycolatopsis sp. [TaxId:37632] [110938] (4 PDB entries)
    Uniprot Q44244; similar activity to a remotely related O-succinylbenzoate synthase from E. coli
  8. 1203448Domain d1sjda2: 1sjd A:1-125 [105633]
    Other proteins in same PDB: d1sjda1, d1sjdb1, d1sjdc1, d1sjdd1
    complexed with npg

Details for d1sjda2

PDB Entry: 1sjd (more details), 1.87 Å

PDB Description: x-ray structure of o-succinylbenzoate synthase complexed with n-succinyl phenylglycine
PDB Compounds: (A:) N-acylamino acid racemase

SCOPe Domain Sequences for d1sjda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sjda2 d.54.1.1 (A:1-125) N-acylamino acid racemase {Amycolatopsis sp. [TaxId: 37632]}
mklsgvelrrvqmplvapfrtsfgtqsvrellllravtpagegwgecvtmagplysseyn
dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
aelgs

SCOPe Domain Coordinates for d1sjda2:

Click to download the PDB-style file with coordinates for d1sjda2.
(The format of our PDB-style files is described here.)

Timeline for d1sjda2: