![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
![]() | Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins) |
![]() | Protein N-acylamino acid racemase [110372] (4 species) |
![]() | Species Amycolatopsis sp. [TaxId:37632] [110373] (4 PDB entries) Uniprot Q44244 # similar activity to a remotely related O-succinylbenzoate synthase from E. coli |
![]() | Domain d1sjda1: 1sjd A:126-367 [105632] Other proteins in same PDB: d1sjda2, d1sjdb2, d1sjdc2, d1sjdd2 complexed with npg |
PDB Entry: 1sjd (more details), 1.87 Å
SCOPe Domain Sequences for d1sjda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sjda1 c.1.11.2 (A:126-367) N-acylamino acid racemase {Amycolatopsis sp. [TaxId: 37632]} vrdsvpcgvsvgimdtipqlldvvggyldegyvriklkiepgwdvepvravrerfgddvl lqvdantaytlgdapqlarldpfglllieqpleeedvlghaelarriqtpicldesivsa raaadaiklgavqivnikpgrvggylearrvhdvcaahgipvwcggmietglgraanval aslpnftlpgdtsasdrfyktditepfvlsgghlpvptgpglgvapipelldevttakvw ig
Timeline for d1sjda1: