Lineage for d1sjcd1 (1sjc D:126-368)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 572967Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 573010Family c.1.11.2: D-glucarate dehydratase-like [51609] (11 proteins)
  6. 573099Protein N-acylamino acid racemase [110372] (4 species)
  7. 573100Species Amycolatopsis sp. [TaxId:37632] [110373] (4 PDB entries)
  8. 573108Domain d1sjcd1: 1sjc D:126-368 [105630]
    Other proteins in same PDB: d1sjca2, d1sjcb2, d1sjcc2, d1sjcd2
    complexed with mg, smg

Details for d1sjcd1

PDB Entry: 1sjc (more details), 2.1 Å

PDB Description: x-ray structure of o-succinylbenzoate synthase complexed with N-succinyl methionine

SCOP Domain Sequences for d1sjcd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sjcd1 c.1.11.2 (D:126-368) N-acylamino acid racemase {Amycolatopsis sp.}
vrdsvpcgvsvgimdtipqlldvvggyldegyvriklkiepgwdvepvravrerfgddvl
lqvdantaytlgdapqlarldpfglllieqpleeedvlghaelarriqtpicldesivsa
raaadaiklgavqivnikpgrvggylearrvhdvcaahgipvwcggmietglgraanval
aslpnftlpgdtsasdrfyktditepfvlsgghlpvptgpglgvapipelldevttakvw
igs

SCOP Domain Coordinates for d1sjcd1:

Click to download the PDB-style file with coordinates for d1sjcd1.
(The format of our PDB-style files is described here.)

Timeline for d1sjcd1: