Lineage for d1sjbc2 (1sjb C:1-125)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 860453Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 860454Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 860455Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 860639Protein N-acylamino acid racemase [110937] (4 species)
  7. 860640Species Amycolatopsis sp. [TaxId:37632] [110938] (4 PDB entries)
    Uniprot Q44244; similar activity to a remotely related O-succinylbenzoate synthase from E. coli
  8. 860651Domain d1sjbc2: 1sjb C:1-125 [105621]
    Other proteins in same PDB: d1sjba1, d1sjbb1, d1sjbc1, d1sjbd1

Details for d1sjbc2

PDB Entry: 1sjb (more details), 2.2 Å

PDB Description: X-ray structure of o-succinylbenzoate synthase complexed with o-succinylbenzoic acid
PDB Compounds: (C:) N-acylamino acid racemase

SCOP Domain Sequences for d1sjbc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sjbc2 d.54.1.1 (C:1-125) N-acylamino acid racemase {Amycolatopsis sp. [TaxId: 37632]}
mklsgvelrrvqmplvapfrtsfgtqsvrellllravtpagegwgecvtmagplysseyn
dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
aelgs

SCOP Domain Coordinates for d1sjbc2:

Click to download the PDB-style file with coordinates for d1sjbc2.
(The format of our PDB-style files is described here.)

Timeline for d1sjbc2: