![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) ![]() |
![]() | Family d.54.1.1: Enolase N-terminal domain-like [54827] (10 proteins) C-terminal domain is beta/alpha-barrel |
![]() | Protein N-acylamino acid racemase [110937] (2 species) |
![]() | Species Amycolatopsis sp. [TaxId:37632] [110938] (4 PDB entries) |
![]() | Domain d1sjbc2: 1sjb C:1-125 [105621] Other proteins in same PDB: d1sjba1, d1sjbb1, d1sjbc1, d1sjbd1 |
PDB Entry: 1sjb (more details), 2.2 Å
SCOP Domain Sequences for d1sjbc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sjbc2 d.54.1.1 (C:1-125) N-acylamino acid racemase {Amycolatopsis sp.} mklsgvelrrvqmplvapfrtsfgtqsvrellllravtpagegwgecvtmagplysseyn dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa aelgs
Timeline for d1sjbc2: