| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) ![]() |
| Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins) C-terminal domain is beta/alpha-barrel |
| Protein N-acylamino acid racemase [110937] (4 species) |
| Species Amycolatopsis sp. [TaxId:37632] [110938] (4 PDB entries) Uniprot Q44244; similar activity to a remotely related O-succinylbenzoate synthase from E. coli |
| Domain d1sjad2: 1sja D:1-125 [105615] Other proteins in same PDB: d1sjaa1, d1sjab1, d1sjac1, d1sjad1 complexed with ame, mg |
PDB Entry: 1sja (more details), 2.3 Å
SCOP Domain Sequences for d1sjad2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sjad2 d.54.1.1 (D:1-125) N-acylamino acid racemase {Amycolatopsis sp. [TaxId: 37632]}
mklsgvelrrvqmplvapfrtsfgtqsvrellllravtpagegwgecvtmagplysseyn
dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
aelgs
Timeline for d1sjad2: