Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins) |
Protein N-acylamino acid racemase [110372] (4 species) |
Species Amycolatopsis sp. [TaxId:37632] [110373] (4 PDB entries) Uniprot Q44244 # similar activity to a remotely related O-succinylbenzoate synthase from E. coli |
Domain d1sjad1: 1sja D:126-368 [105614] Other proteins in same PDB: d1sjaa2, d1sjab2, d1sjac2, d1sjad2 complexed with ame, mg |
PDB Entry: 1sja (more details), 2.3 Å
SCOPe Domain Sequences for d1sjad1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sjad1 c.1.11.2 (D:126-368) N-acylamino acid racemase {Amycolatopsis sp. [TaxId: 37632]} vrdsvpcgvsvgimdtipqlldvvggyldegyvriklkiepgwdvepvravrerfgddvl lqvdantaytlgdapqlarldpfglllieqpleeedvlghaelarriqtpicldesivsa raaadaiklgavqivnikpgrvggylearrvhdvcaahgipvwcggmietglgraanval aslpnftlpgdtsasdrfyktditepfvlsgghlpvptgpglgvapipelldevttakvw igs
Timeline for d1sjad1: