Lineage for d1sjac2 (1sja C:1-125)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503550Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 503551Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 503552Family d.54.1.1: Enolase N-terminal domain-like [54827] (10 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 503678Protein N-acylamino acid racemase [110937] (2 species)
  7. 503679Species Amycolatopsis sp. [TaxId:37632] [110938] (4 PDB entries)
  8. 503694Domain d1sjac2: 1sja C:1-125 [105613]
    Other proteins in same PDB: d1sjaa1, d1sjab1, d1sjac1, d1sjad1

Details for d1sjac2

PDB Entry: 1sja (more details), 2.3 Å

PDB Description: X-ray structure of o-Succinylbenzoate Synthase complexed with N-acetylmethionine

SCOP Domain Sequences for d1sjac2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sjac2 d.54.1.1 (C:1-125) N-acylamino acid racemase {Amycolatopsis sp.}
mklsgvelrrvqmplvapfrtsfgtqsvrellllravtpagegwgecvtmagplysseyn
dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
aelgs

SCOP Domain Coordinates for d1sjac2:

Click to download the PDB-style file with coordinates for d1sjac2.
(The format of our PDB-style files is described here.)

Timeline for d1sjac2: