SCOP 1.71: Domain d1sjab2: 1sja B:1-125

Lineage for d1sjab2 (1sja B:1-125)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (12 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein N-acylamino acid racemase [110937] (4 species)

7. Species Amycolatopsis sp. [TaxId:37632] [110938] (4 PDB entries)

8. Domain d1sjab2: 1sja B:1-125 [105611]
   Other proteins in same PDB: d1sjaa1, d1sjab1, d1sjac1, d1sjad1

Details for d1sjab2

PDB Entry: 1sja, 2.3 Å

PDB Description: X-ray structure of o-Succinylbenzoate Synthase complexed with N-acetylmethionine

SCOP Domain Sequences for d1sjab2:

Sequence; same for both SEQRES and ATOM records:

>d1sjab2 d.54.1.1 (B:1-125) N-acylamino acid racemase {Amycolatopsis sp.}
mklsgvelrrvqmplvapfrtsfgtqsvrellllravtpagegwgecvtmagplysseyn
dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
aelgs

Timeline for d1sjab2:

• d1sjab2 first appeared in SCOP 1.69
  
• d1sjab2 appears in SCOP 1.73
  
• d1sjab2 appears in the current release, SCOPe 2.08