SCOPe 2.07: Domain d1sj8a2: 1sj8 A:658-782

Lineage for d1sj8a2 (1sj8 A:658-782)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.216: I/LWEQ domain [109884] (1 superfamily)
   5 helices; bundle, closed, left-handed twist

4. Superfamily a.216.1: I/LWEQ domain [109885] (1 family)

5. Family a.216.1.1: I/LWEQ domain [109886] (2 proteins)
   Pfam PF01608
   actin-binding motif that adopts different folds; possibly refolds upon binding

6. Protein Talin 1 [109889] (1 species)
   4-helical bundle of the Bromodomain-like fold (47363); similar to helices 2-5 of the Huntingtin interacting protein 12

7. Species Mouse (Mus musculus) [TaxId:10090] [109890] (2 PDB entries)
   Uniprot P26039 486-782

8. Domain d1sj8a2: 1sj8 A:658-782 [105607]
   Other proteins in same PDB: d1sj8a1

Details for d1sj8a2

PDB Entry: 1sj8, 2.6 Å

PDB Description: solution structure of the r1r2 domains of talin

PDB Compounds: (A:) Talin 1

SCOPe Domain Sequences for d1sj8a2:

Sequence; same for both SEQRES and ATOM records:

>d1sj8a2 a.216.1.1 (A:658-782) Talin 1 {Mouse (Mus musculus) [TaxId: 10090]}
sdtdphfqdvlmqlanavasaaaalvlkaksvaqrtedsglqtqviaaatqcalstsqlv
actkvvaptisspvcqeqlveagrlvakavegcvsasqaatedgqllrgvgaaatavtqa
lnell

Timeline for d1sj8a2:

• d1sj8a2 first appeared in SCOP 1.69
  
• d1sj8a2 appears in SCOPe 2.06
  
• d1sj8a2 appears in the current release, SCOPe 2.08