Lineage for d1sj8a2 (1sj8 A:658-782)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015542Fold a.216: I/LWEQ domain [109884] (1 superfamily)
    5 helices; bundle, closed, left-handed twist
  4. 2015543Superfamily a.216.1: I/LWEQ domain [109885] (1 family) (S)
  5. 2015544Family a.216.1.1: I/LWEQ domain [109886] (2 protein domains)
    Pfam PF01608
    actin-binding motif that adopts different folds; possibly refolds upon binding
  6. 2015555Protein Talin 1 [109889] (1 species)
    4-helical bundle of the Bromodomain-like fold (47363); similar to helices 2-5 of the Huntingtin interacting protein 12
  7. 2015556Species Mouse (Mus musculus) [TaxId:10090] [109890] (2 PDB entries)
    Uniprot P26039 486-782
  8. 2015557Domain d1sj8a2: 1sj8 A:658-782 [105607]
    Other proteins in same PDB: d1sj8a1

Details for d1sj8a2

PDB Entry: 1sj8 (more details), 2.6 Å

PDB Description: Crystal Structure of talin residues 482-789
PDB Compounds: (A:) Talin 1

SCOPe Domain Sequences for d1sj8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sj8a2 a.216.1.1 (A:658-782) Talin 1 {Mouse (Mus musculus) [TaxId: 10090]}
sdtdphfqdvlmqlanavasaaaalvlkaksvaqrtedsglqtqviaaatqcalstsqlv
actkvvaptisspvcqeqlveagrlvakavegcvsasqaatedgqllrgvgaaatavtqa
lnell

SCOPe Domain Coordinates for d1sj8a2:

Click to download the PDB-style file with coordinates for d1sj8a2.
(The format of our PDB-style files is described here.)

Timeline for d1sj8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sj8a1