![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.216: I/LWEQ domain [109884] (1 superfamily) 5 helices; bundle, closed, left-handed twist |
![]() | Superfamily a.216.1: I/LWEQ domain [109885] (1 family) ![]() |
![]() | Family a.216.1.1: I/LWEQ domain [109886] (2 proteins) Pfam PF01608 actin-binding motif that adopts different folds; possibly refolds upon binding |
![]() | Protein Talin 1 [109889] (1 species) 4-helical bundle of the Bromodomain-like fold (47363); similar to helices 2-5 of the Huntingtin interacting protein 12 |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [109890] (2 PDB entries) Uniprot P26039 486-782 |
![]() | Domain d1sj8a2: 1sj8 A:658-782 [105607] Other proteins in same PDB: d1sj8a1 |
PDB Entry: 1sj8 (more details), 2.6 Å
SCOPe Domain Sequences for d1sj8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sj8a2 a.216.1.1 (A:658-782) Talin 1 {Mouse (Mus musculus) [TaxId: 10090]} sdtdphfqdvlmqlanavasaaaalvlkaksvaqrtedsglqtqviaaatqcalstsqlv actkvvaptisspvcqeqlveagrlvakavegcvsasqaatedgqllrgvgaaatavtqa lnell
Timeline for d1sj8a2: