SCOPe 2.06: Domain d1sj8a1: 1sj8 A:488-654

Lineage for d1sj8a1 (1sj8 A:488-654)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.215: A middle domain of Talin 1 [109879] (1 superfamily)
   5 helices; bundle, closed, left-handed twist; helices 2-5 adopt the Four-helical up-and-down bundle fold (47161)

4. Superfamily a.215.1: A middle domain of Talin 1 [109880] (1 family)
   automatically mapped to Pfam PF09141

5. Family a.215.1.1: A middle domain of Talin 1 [109881] (1 protein)

6. Protein A middle domain of Talin 1 [109882] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [109883] (2 PDB entries)
   Uniprot P26039 486-782

8. Domain d1sj8a1: 1sj8 A:488-654 [105606]
   Other proteins in same PDB: d1sj8a2

Details for d1sj8a1

PDB Entry: 1sj8, 2.6 Å

PDB Description: solution structure of the r1r2 domains of talin

PDB Compounds: (A:) Talin 1

SCOPe Domain Sequences for d1sj8a1:

Sequence; same for both SEQRES and ATOM records:

>d1sj8a1 a.215.1.1 (A:488-654) A middle domain of Talin 1 {Mouse (Mus musculus) [TaxId: 10090]}
ltsaqqaltgtinssmqavqaaqatlddfetlpplgqdaaskawrknkmdeskheihsqv
daitagtasvvnltagdpaetdytavgcavttissnltemsrgvkllaalledeggngrp
llqaakglagavsellrsaqpasaeprqnllqaagnvgqasgellqq

Timeline for d1sj8a1:

• d1sj8a1 first appeared in SCOP 1.69
  
• d1sj8a1 appears in SCOPe 2.05
  
• d1sj8a1 appears in SCOPe 2.07
  
• d1sj8a1 appears in the current release, SCOPe 2.08