Class a: All alpha proteins [46456] (286 folds) |
Fold a.215: A middle domain of Talin 1 [109879] (1 superfamily) 5 helices; bundle, closed, left-handed twist; helices 2-5 adopt the Four-helical up-and-down bundle fold (47161) |
Superfamily a.215.1: A middle domain of Talin 1 [109880] (1 family) automatically mapped to Pfam PF09141 |
Family a.215.1.1: A middle domain of Talin 1 [109881] (1 protein) |
Protein A middle domain of Talin 1 [109882] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [109883] (2 PDB entries) Uniprot P26039 486-782 |
Domain d1sj7b1: 1sj7 B:488-654 [105604] complexed with pt |
PDB Entry: 1sj7 (more details), 2.5 Å
SCOPe Domain Sequences for d1sj7b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sj7b1 a.215.1.1 (B:488-654) A middle domain of Talin 1 {Mouse (Mus musculus) [TaxId: 10090]} ltsaqqaltgtinssmqavqaaqatlddfetlpplgqdaaskawrknkmdeskheihsqv daitagtasvvnltagdpaetdytavgcavttissnltemsrgvkllaalledeggngrp llqaakglagavsellrsaqpasaeprqnllqaagnvgqasgellqq
Timeline for d1sj7b1: