SCOPe 2.05: Domain d1sj7b1: 1sj7 B:488-654

Lineage for d1sj7b1 (1sj7 B:488-654)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.215: A middle domain of Talin 1 [109879] (1 superfamily)
   5 helices; bundle, closed, left-handed twist; helices 2-5 adopt the Four-helical up-and-down bundle fold (47161)

4. Superfamily a.215.1: A middle domain of Talin 1 [109880] (1 family)
   automatically mapped to Pfam PF09141

5. Family a.215.1.1: A middle domain of Talin 1 [109881] (1 protein)

6. Protein A middle domain of Talin 1 [109882] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [109883] (2 PDB entries)
   Uniprot P26039 486-782

8. Domain d1sj7b1: 1sj7 B:488-654 [105604]
   complexed with pt

Details for d1sj7b1

PDB Entry: 1sj7, 2.5 Å

PDB Description: Crystal Structure of Talin Rod 482-655

PDB Compounds: (B:) Talin 1

SCOPe Domain Sequences for d1sj7b1:

Sequence; same for both SEQRES and ATOM records:

>d1sj7b1 a.215.1.1 (B:488-654) A middle domain of Talin 1 {Mouse (Mus musculus) [TaxId: 10090]}
ltsaqqaltgtinssmqavqaaqatlddfetlpplgqdaaskawrknkmdeskheihsqv
daitagtasvvnltagdpaetdytavgcavttissnltemsrgvkllaalledeggngrp
llqaakglagavsellrsaqpasaeprqnllqaagnvgqasgellqq

Timeline for d1sj7b1:

• d1sj7b1 first appeared in SCOP 1.69
  
• d1sj7b1 appears in SCOPe 2.04
  
• d1sj7b1 appears in SCOPe 2.06
  
• d1sj7b1 appears in the current release, SCOPe 2.08