Lineage for d1sj4p_ (1sj4 P:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 504527Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) (S)
  5. 504528Family d.58.7.1: Canonical RBD [54929] (20 proteins)
  6. 504653Protein Splicesomal U1A protein [54932] (1 species)
    duplication: contains two domains of this fold
  7. 504654Species Human (Homo sapiens) [TaxId:9606] [54933] (24 PDB entries)
  8. 504675Domain d1sj4p_: 1sj4 P: [105602]

Details for d1sj4p_

PDB Entry: 1sj4 (more details), 2.7 Å

PDB Description: crystal structure of a c75u mutant hepatitis delta virus ribozyme precursor, in cu2+ solution

SCOP Domain Sequences for d1sj4p_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sj4p_ d.58.7.1 (P:) Splicesomal U1A protein {Human (Homo sapiens)}
petrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevs
satnalrsmqgfpfydkpmriqyaktdsdiiakmk

SCOP Domain Coordinates for d1sj4p_:

Click to download the PDB-style file with coordinates for d1sj4p_.
(The format of our PDB-style files is described here.)

Timeline for d1sj4p_: