![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (49 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (20 proteins) |
![]() | Protein Splicesomal U1A protein [54932] (1 species) duplication: contains two domains of this fold |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54933] (24 PDB entries) |
![]() | Domain d1sj3p_: 1sj3 P: [105601] |
PDB Entry: 1sj3 (more details), 2.2 Å
SCOP Domain Sequences for d1sj3p_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sj3p_ d.58.7.1 (P:) Splicesomal U1A protein {Human (Homo sapiens)} petrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevs satnalrsmqgfpfydkpmriqyaktdsdiiakmk
Timeline for d1sj3p_: