SCOPe 2.05: Domain d1sj2b1: 1sj2 B:24-435

Lineage for d1sj2b1 (1sj2 B:24-435)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.3: Catalase-peroxidase KatG [74753] (2 proteins)
   duplication: tandem repeat of two CCP-like domains

6. Protein Catalase-peroxidase KatG [74754] (4 species)
   only the N-terminal CCP-like domain binds heme

7. Species Mycobacterium tuberculosis [TaxId:1773] [109941] (1 PDB entry)
   Uniprot Q08129

8. Domain d1sj2b1: 1sj2 B:24-435 [105599]
   complexed with gol, hem

Details for d1sj2b1

PDB Entry: 1sj2, 2.41 Å

PDB Description: Crystal structure of Mycobacterium tuberculosis catalase-peroxidase

PDB Compounds: (B:) peroxidase/catalase t

SCOPe Domain Sequences for d1sj2b1:

Sequence; same for both SEQRES and ATOM records:

>d1sj2b1 a.93.1.3 (B:24-435) Catalase-peroxidase KatG {Mycobacterium tuberculosis [TaxId: 1773]}
ghmkypvegggnqdwwpnrlnlkvlhqnpavadpmgaafdyaaevatidvdaltrdieev
mttsqpwwpadyghygplfirmawhaagtyrihdgrggagggmqrfaplnswpdnasldk
arrllwpvkkkygkklswadlivfagncalesmgfktfgfgfgrvdqwepdevywgkeat
wlgderysgkrdlenplaavqmgliyvnpegpngnpdpmaaavdiretfrrmamndveta
alivgghtfgkthgagpadlvgpepeaapleqmglgwkssygtgtgkdaitsgievvwtn
tptkwdnsfleilygyeweltkspagawqytakdgagagtipdpfggpgrsptmlatdls
lrvdpiyeritrrwlehpeeladefakawyklihrdmgpvarylgplvpkqt

Timeline for d1sj2b1:

• d1sj2b1 first appeared in SCOP 1.69
  
• d1sj2b1 appears in SCOPe 2.04
  
• d1sj2b1 appears in SCOPe 2.06
  
• d1sj2b1 appears in the current release, SCOPe 2.08