SCOPe 2.07: Domain d1sj1b_: 1sj1 B:

Lineage for d1sj1b_ (1sj1 B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families)

5. Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (5 proteins)
   contains only one 4Fe-4S cluster
   automatically mapped to Pfam PF13459
   automatically mapped to Pfam PF13370

6. Protein Fe3S4-ferredoxin PF1909 [110946] (1 species)

7. Species Pyrococcus furiosus [TaxId:2261] [110947] (4 PDB entries)
   Uniprot P29603

8. Domain d1sj1b_: 1sj1 B: [105596]
   complexed with f3s, nco

Details for d1sj1b_

PDB Entry: 1sj1, 1.5 Å

PDB Description: The 1.5 A Resolution Crystal Structure of [Fe3S4]-Ferredoxin from the hyperthermophilic Archaeon Pyrococcus furiosus

PDB Compounds: (B:) ferredoxin

SCOPe Domain Sequences for d1sj1b_:

Sequence; same for both SEQRES and ATOM records:

>d1sj1b_ d.58.1.4 (B:) Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxId: 2261]}
awkvsvdqdtcigdaicaslcpdvfemndegkaqpkveviedeelyncakeameacpvsa
itieea

Timeline for d1sj1b_:

• d1sj1b_ first appeared in SCOP 1.69
  
• d1sj1b_ appears in SCOPe 2.06
  
• d1sj1b_ appears in the current release, SCOPe 2.08