Lineage for d1sj1b_ (1sj1 B:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 603244Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) (S)
  5. 603317Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (4 proteins)
    contains only one 4Fe-4S cluster
  6. 603318Protein Fe3S4-ferredoxin PF1909 [110946] (1 species)
  7. 603319Species Pyrococcus furiosus [TaxId:186497] [110947] (2 PDB entries)
  8. 603321Domain d1sj1b_: 1sj1 B: [105596]
    complexed with f3s, nco

Details for d1sj1b_

PDB Entry: 1sj1 (more details), 1.5 Å

PDB Description: The 1.5 A Resolution Crystal Structure of [Fe3S4]-Ferredoxin from the hyperthermophilic Archaeon Pyrococcus furiosus

SCOP Domain Sequences for d1sj1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sj1b_ d.58.1.4 (B:) Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus}
awkvsvdqdtcigdaicaslcpdvfemndegkaqpkveviedeelyncakeameacpvsa
itieea

SCOP Domain Coordinates for d1sj1b_:

Click to download the PDB-style file with coordinates for d1sj1b_.
(The format of our PDB-style files is described here.)

Timeline for d1sj1b_: