Lineage for d1sj1a_ (1sj1 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2192664Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2192764Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (5 proteins)
    contains only one 4Fe-4S cluster
    automatically mapped to Pfam PF13459
    automatically mapped to Pfam PF13370
  6. 2192765Protein Fe3S4-ferredoxin PF1909 [110946] (1 species)
  7. 2192766Species Pyrococcus furiosus [TaxId:2261] [110947] (4 PDB entries)
    Uniprot P29603
  8. 2192767Domain d1sj1a_: 1sj1 A: [105595]
    complexed with f3s, nco

Details for d1sj1a_

PDB Entry: 1sj1 (more details), 1.5 Å

PDB Description: The 1.5 A Resolution Crystal Structure of [Fe3S4]-Ferredoxin from the hyperthermophilic Archaeon Pyrococcus furiosus
PDB Compounds: (A:) ferredoxin

SCOPe Domain Sequences for d1sj1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sj1a_ d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxId: 2261]}
awkvsvdqdtcigdaicaslcpdvfemndegkaqpkveviedeelyncakeameacpvsa
itieea

SCOPe Domain Coordinates for d1sj1a_:

Click to download the PDB-style file with coordinates for d1sj1a_.
(The format of our PDB-style files is described here.)

Timeline for d1sj1a_: