Lineage for d1sj1a_ (1sj1 A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 861004Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) (S)
  5. 861077Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (4 proteins)
    contains only one 4Fe-4S cluster
  6. 861078Protein Fe3S4-ferredoxin PF1909 [110946] (1 species)
  7. 861079Species Pyrococcus furiosus [TaxId:2261] [110947] (2 PDB entries)
    Uniprot P29603
  8. 861080Domain d1sj1a_: 1sj1 A: [105595]

Details for d1sj1a_

PDB Entry: 1sj1 (more details), 1.5 Å

PDB Description: The 1.5 A Resolution Crystal Structure of [Fe3S4]-Ferredoxin from the hyperthermophilic Archaeon Pyrococcus furiosus
PDB Compounds: (A:) ferredoxin

SCOP Domain Sequences for d1sj1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sj1a_ d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxId: 2261]}
awkvsvdqdtcigdaicaslcpdvfemndegkaqpkveviedeelyncakeameacpvsa
itieea

SCOP Domain Coordinates for d1sj1a_:

Click to download the PDB-style file with coordinates for d1sj1a_.
(The format of our PDB-style files is described here.)

Timeline for d1sj1a_: