SCOP 1.73: Domain d1sj1a_: 1sj1 A:

Lineage for d1sj1a_ (1sj1 A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families)

5. Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (4 proteins)
   contains only one 4Fe-4S cluster

6. Protein Fe3S4-ferredoxin PF1909 [110946] (1 species)

7. Species Pyrococcus furiosus [TaxId:2261] [110947] (2 PDB entries)

8. Domain d1sj1a_: 1sj1 A: [105595]

Details for d1sj1a_

PDB Entry: 1sj1, 1.5 Å

PDB Description: The 1.5 A Resolution Crystal Structure of [Fe3S4]-Ferredoxin from the hyperthermophilic Archaeon Pyrococcus furiosus

PDB Compounds: (A:) ferredoxin

SCOP Domain Sequences for d1sj1a_:

Sequence; same for both SEQRES and ATOM records:

>d1sj1a_ d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxId: 2261]}
awkvsvdqdtcigdaicaslcpdvfemndegkaqpkveviedeelyncakeameacpvsa
itieea

Timeline for d1sj1a_:

• d1sj1a_ first appeared in SCOP 1.69
  
• d1sj1a_ appears in SCOP 1.71
  
• d1sj1a_ appears in SCOP 1.75
  
• d1sj1a_ appears in the current release, SCOPe 2.08