SCOP 1.75: Domain d1sizc_: 1siz C:

Lineage for d1sizc_ (1siz C:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families)

5. Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (4 proteins)
   contains only one 4Fe-4S cluster

6. Protein Fe3S4-ferredoxin PF1909 [110946] (1 species)

7. Species Pyrococcus furiosus [TaxId:2261] [110947] (2 PDB entries)
   Uniprot P29603

8. Domain d1sizc_: 1siz C: [105594]
   complexed with 3co, f3s

Details for d1sizc_

PDB Entry: 1siz, 2.25 Å

PDB Description: Crystal structure of the [Fe3S4]-ferredoxin from the hyperthermophilic archaeon Pyrococcus furiosus

PDB Compounds: (C:) ferredoxin

SCOP Domain Sequences for d1sizc_:

Sequence; same for both SEQRES and ATOM records:

>d1sizc_ d.58.1.4 (C:) Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxId: 2261]}
awkvsvdqdtcigdaicaslcpdvfemndegkaqpkveviedeelyncakeameacpvsa
itieea

Timeline for d1sizc_:

• d1sizc_ first appeared in SCOP 1.69
  
• d1sizc_ appears in SCOP 1.73
  
• d1sizc_ appears in SCOPe 2.01
  
• d1sizc_ appears in the current release, SCOPe 2.08