Lineage for d1sizc_ (1siz C:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 503918Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) (S)
  5. 503991Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (4 proteins)
    contains only one 4Fe-4S cluster
  6. 503992Protein Fe3S4-ferredoxin PF1909 [110946] (1 species)
  7. 503993Species Pyrococcus furiosus [TaxId:186497] [110947] (2 PDB entries)
  8. 503997Domain d1sizc_: 1siz C: [105594]

Details for d1sizc_

PDB Entry: 1siz (more details), 2.25 Å

PDB Description: Crystal structure of the [Fe3S4]-ferredoxin from the hyperthermophilic archaeon Pyrococcus furiosus

SCOP Domain Sequences for d1sizc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sizc_ d.58.1.4 (C:) Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus}
awkvsvdqdtcigdaicaslcpdvfemndegkaqpkveviedeelyncakeameacpvsa
itieea

SCOP Domain Coordinates for d1sizc_:

Click to download the PDB-style file with coordinates for d1sizc_.
(The format of our PDB-style files is described here.)

Timeline for d1sizc_: