SCOP 1.73: Domain d1siwa1: 1siw A:1075-1243

Lineage for d1siwa1 (1siw A:1075-1243)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (3 families)

5. Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins)
   molybdopterine enzyme

6. Protein Respiratory nitrate reductase 1 alpha chain [101828] (1 species)

7. Species Escherichia coli [TaxId:562] [101829] (7 PDB entries)

8. Domain d1siwa1: 1siw A:1075-1243 [105589]
   Other proteins in same PDB: d1siwa2, d1siwb_, d1siwc_
   complexed with 3ph, f3s, gdp, hem, sf4

Details for d1siwa1

PDB Entry: 1siw, 2.2 Å

PDB Description: crystal structure of the apomolybdo-narghi

PDB Compounds: (A:) Respiratory nitrate reductase 1 alpha chain

SCOP Domain Sequences for d1siwa1:

Sequence; same for both SEQRES and ATOM records:

>d1siwa1 b.52.2.2 (A:1075-1243) Respiratory nitrate reductase 1 alpha chain {Escherichia coli [TaxId: 562]}
gqksngnqekalnfltphqkwgihstysdnllmltlgrggpvvwlseadakdlgiadndw
ievfnsngaltaravvsqrvpagmtmmyhaqerivnlpgseitqqrggihnsvtritpkp
thmiggyahlaygfnyygtvgsnrdefvvvrkmknidwldgegndqvqe

Timeline for d1siwa1:

• d1siwa1 first appeared in SCOP 1.69
  
• d1siwa1 appears in SCOP 1.71
  
• d1siwa1 appears in SCOP 1.75
  
• d1siwa1 appears in the current release, SCOPe 2.08