![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
![]() | Superfamily b.52.2: ADC-like [50692] (3 families) ![]() |
![]() | Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (9 proteins) molybdopterine enzyme |
![]() | Protein Respiratory nitrate reductase 1 alpha chain [101828] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [101829] (3 PDB entries) |
![]() | Domain d1siwa1: 1siw A:1075-1243 [105589] Other proteins in same PDB: d1siwa2, d1siwb_, d1siwc_ |
PDB Entry: 1siw (more details), 2.2 Å
SCOP Domain Sequences for d1siwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1siwa1 b.52.2.2 (A:1075-1243) Respiratory nitrate reductase 1 alpha chain {Escherichia coli} gqksngnqekalnfltphqkwgihstysdnllmltlgrggpvvwlseadakdlgiadndw ievfnsngaltaravvsqrvpagmtmmyhaqerivnlpgseitqqrggihnsvtritpkp thmiggyahlaygfnyygtvgsnrdefvvvrkmknidwldgegndqvqe
Timeline for d1siwa1: