Lineage for d1sija4 (1sij A:311-907)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.133: Molybdenum cofactor-binding domain [56002] (1 superfamily)
    beta(2)-alpha-beta-alpha-beta; 2 layers: a/b; mixed sheet: order 1243: crossing loops
  4. Superfamily d.133.1: Molybdenum cofactor-binding domain [56003] (2 families) (S)
    duplication: consists of 4 structural repeats arranged in 2 lobes
    contains one left-hand beta-alpha-beta unit per lobe
    automatically mapped to Pfam PF02738
  5. Family d.133.1.1: Molybdenum cofactor-binding domain [56004] (7 proteins)
  6. Protein Aldehyde oxidoreductase [56005] (2 species)
  7. Species Desulfovibrio gigas [TaxId:879] [56006] (12 PDB entries)
    Uniprot Q46509
  8. Domain d1sija4: 1sij A:311-907 [105584]
    Other proteins in same PDB: d1sija1, d1sija2, d1sija3
    complexed with ast, cl, fes, mg, pcd

Details for d1sija4

PDB Entry: 1sij (more details), 2.3 Å

PDB Description: Crystal structure of the Aldehyde Dehydrogenase (a.k.a. AOR or MOP) of Desulfovibrio gigas covalently bound to [AsO3]-
PDB Compounds: (A:) aldehyde oxidoreductase

SCOPe Domain Sequences for d1sija4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sija4 d.133.1.1 (A:311-907) Aldehyde oxidoreductase {Desulfovibrio gigas [TaxId: 879]}
msgpaaaaedaieihpgtpnvyfeqpivkgedtgpifasadvtvegdfyvgrqphmpiep
dvafaymgddgkcyihsksigvhlhlymiapgvglepdqlvlvanpmggtfgykfsptse
alvavaamatgrpvhlrynyqqqqqytgkrspwemnvkfaakkdgtllamesdwlvdhgp
ysefgdlltlrgaqfigagynipnirglgrtvatnhvwgsafrgygapqsmfaseclmdm
laeklgmdplelryknayrpgdtnptgqepevfslpdmidqlrpkyqaalekaqkestat
hkkgvgisigvygsgldgpdaseawaelnadgtitvhtawedhgqgadigcvgtahealr
pmgvapekikftwpntattpnsgpsggsrqqvmtgnairvacenllkacekpgggyytyd
elkaadkptkitgnwtasgathcdavtglgkpfvvymygvfmaevtvdvatgqttvdgmt
lmadlgslcnqlatdgqiygglaqgiglalsedfedikkhatlvgagfpfikqipdkldi
vyvnhprpdgpfgasgvgelpltsphaaiinaiksatgvriyrlpaypekvlealka

SCOPe Domain Coordinates for d1sija4 are not available.

Timeline for d1sija4:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sija1, d1sija2, d1sija3