![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
![]() | Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families) ![]() |
![]() | Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (6 proteins) |
![]() | Protein Aldehyde oxidoreductase, domain 3 [54667] (2 species) |
![]() | Species Desulfovibrio gigas [TaxId:879] [54668] (11 PDB entries) Uniprot Q46509 |
![]() | Domain d1sija3: 1sij A:194-310 [105583] Other proteins in same PDB: d1sija1, d1sija2, d1sija4 complexed with ast, cl, fes, mg, pcd |
PDB Entry: 1sij (more details), 2.3 Å
SCOPe Domain Sequences for d1sija3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sija3 d.41.1.1 (A:194-310) Aldehyde oxidoreductase, domain 3 {Desulfovibrio gigas [TaxId: 879]} dygadlglkmpagtlhlamvqakvshanikgidtsealtmpgvhsvithkdvkgknritg litfptnkgdgwdrpilcdekvfqygdcialvcadseanaraaaekvkvdleelpay
Timeline for d1sija3: