Lineage for d1sija3 (1sij A:194-310)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1410866Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 1410867Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families) (S)
  5. 1410868Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (6 proteins)
  6. 1410875Protein Aldehyde oxidoreductase, domain 3 [54667] (2 species)
  7. 1410878Species Desulfovibrio gigas [TaxId:879] [54668] (8 PDB entries)
    Uniprot Q46509
  8. 1410886Domain d1sija3: 1sij A:194-310 [105583]
    Other proteins in same PDB: d1sija1, d1sija2, d1sija4
    complexed with ast, cl, fes, mg, pcd

Details for d1sija3

PDB Entry: 1sij (more details), 2.3 Å

PDB Description: Crystal structure of the Aldehyde Dehydrogenase (a.k.a. AOR or MOP) of Desulfovibrio gigas covalently bound to [AsO3]-
PDB Compounds: (A:) aldehyde oxidoreductase

SCOPe Domain Sequences for d1sija3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sija3 d.41.1.1 (A:194-310) Aldehyde oxidoreductase, domain 3 {Desulfovibrio gigas [TaxId: 879]}
dygadlglkmpagtlhlamvqakvshanikgidtsealtmpgvhsvithkdvkgknritg
litfptnkgdgwdrpilcdekvfqygdcialvcadseanaraaaekvkvdleelpay

SCOPe Domain Coordinates for d1sija3:

Click to download the PDB-style file with coordinates for d1sija3.
(The format of our PDB-style files is described here.)

Timeline for d1sija3: