Lineage for d1sija2 (1sij A:1-80)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1403183Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 1403347Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 1403354Protein Aldehyde oxidoreductase, N-terminal domain [54315] (2 species)
  7. 1403357Species Desulfovibrio gigas [TaxId:879] [54316] (8 PDB entries)
    Uniprot Q46509
  8. 1403365Domain d1sija2: 1sij A:1-80 [105582]
    Other proteins in same PDB: d1sija1, d1sija3, d1sija4
    complexed with ast, cl, fes, mg, pcd

Details for d1sija2

PDB Entry: 1sij (more details), 2.3 Å

PDB Description: Crystal structure of the Aldehyde Dehydrogenase (a.k.a. AOR or MOP) of Desulfovibrio gigas covalently bound to [AsO3]-
PDB Compounds: (A:) aldehyde oxidoreductase

SCOPe Domain Sequences for d1sija2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sija2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio gigas [TaxId: 879]}
miqkvitvngieqnlfvdaeallsdvlrqqlgltgvkvgceqgqcgacsvildgkvvrac
vtkmkrvadgaqittiegvg

SCOPe Domain Coordinates for d1sija2:

Click to download the PDB-style file with coordinates for d1sija2.
(The format of our PDB-style files is described here.)

Timeline for d1sija2: