Lineage for d1sija1 (1sij A:81-193)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 642696Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 642697Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (1 family) (S)
    contains 2Fe-2S cluster
  5. 642698Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (6 proteins)
  6. 642705Protein Aldehyde oxidoreductase, domain 2 [47743] (2 species)
  7. 642708Species Desulfovibrio gigas [TaxId:879] [47744] (3 PDB entries)
  8. 642711Domain d1sija1: 1sij A:81-193 [105581]
    Other proteins in same PDB: d1sija2, d1sija3, d1sija4
    complexed with ast, cl, fes, mg, pcd

Details for d1sija1

PDB Entry: 1sij (more details), 2.3 Å

PDB Description: Crystal structure of the Aldehyde Dehydrogenase (a.k.a. AOR or MOP) of Desulfovibrio gigas covalently bound to [AsO3]-
PDB Compounds: (A:) aldehyde oxidoreductase

SCOP Domain Sequences for d1sija1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sija1 a.56.1.1 (A:81-193) Aldehyde oxidoreductase, domain 2 {Desulfovibrio gigas [TaxId: 879]}
qpenlhplqkawvlhggaqcgfcspgfivsakglldtnadpsredvrdwfqkhrnacrct
gykplvdavmdaaavingkkpetdlefkmpadgriwgskyprptavakvtgtl

SCOP Domain Coordinates for d1sija1:

Click to download the PDB-style file with coordinates for d1sija1.
(The format of our PDB-style files is described here.)

Timeline for d1sija1: