Lineage for d1sija1 (1sij A:81-193)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715250Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 2715251Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) (S)
    contains 2Fe-2S cluster
  5. 2715252Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins)
  6. 2715259Protein Aldehyde oxidoreductase, domain 2 [47743] (2 species)
  7. 2715262Species Desulfovibrio gigas [TaxId:879] [47744] (12 PDB entries)
    Uniprot Q46509
  8. 2715274Domain d1sija1: 1sij A:81-193 [105581]
    Other proteins in same PDB: d1sija2, d1sija3, d1sija4
    complexed with ast, cl, fes, mg, pcd

Details for d1sija1

PDB Entry: 1sij (more details), 2.3 Å

PDB Description: Crystal structure of the Aldehyde Dehydrogenase (a.k.a. AOR or MOP) of Desulfovibrio gigas covalently bound to [AsO3]-
PDB Compounds: (A:) aldehyde oxidoreductase

SCOPe Domain Sequences for d1sija1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sija1 a.56.1.1 (A:81-193) Aldehyde oxidoreductase, domain 2 {Desulfovibrio gigas [TaxId: 879]}
qpenlhplqkawvlhggaqcgfcspgfivsakglldtnadpsredvrdwfqkhrnacrct
gykplvdavmdaaavingkkpetdlefkmpadgriwgskyprptavakvtgtl

SCOPe Domain Coordinates for d1sija1:

Click to download the PDB-style file with coordinates for d1sija1.
(The format of our PDB-style files is described here.)

Timeline for d1sija1: