Lineage for d1siia1 (1sii A:212-628)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 460730Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 460731Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
  5. 460732Family b.30.2.1: Amine oxidase catalytic domain [49999] (2 proteins)
  6. 460733Protein Copper amine oxidase, domain 3 [50000] (4 species)
  7. 460734Species Arthrobacter globiformis [TaxId:1665] [50003] (14 PDB entries)
  8. 460736Domain d1siia1: 1sii A:212-628 [105578]
    Other proteins in same PDB: d1siia2, d1siia3

Details for d1siia1

PDB Entry: 1sii (more details), 1.7 Å

PDB Description: agao in covalent complex with the inhibitor noba ("4-(2-naphthyloxy)- 2-butyn-1-amine")
PDB Compounds: (A:)

SCOP Domain Sequences for d1siia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1siia1 b.30.2.1 (A:212-628) Copper amine oxidase, domain 3 {Arthrobacter globiformis}
plrttqkpisitqpegpsftvtggnhiewekwsldvgfdvregvvlhniafrdgdrlrpi
inrasiaemvvpygdpspirswqnyfdtgeylvgqyanslelgcdclgditylspvisda
fgnpreirngicmheedwgilakhsdlwsginytrrnrrmvisffttignydygfywyly
ldgtiefeakatgvvftsafpeggsdnisqlapglgapfhqhifsarldmaidgftnrve
eedvvrqtmgpgnergnafsrkrtvltreseavreadartgrtwiisnpesknrlnepvg
yklhahnqptlladpgssiarraafatkdlwvtryadderyptgdfvnqhsggaglpsyi
aqdrdidgqdivvwhtfglthfprvedwpimpvdtvgfklrpegffdrspvldvpan

SCOP Domain Coordinates for d1siia1:

Click to download the PDB-style file with coordinates for d1siia1.
(The format of our PDB-style files is described here.)

Timeline for d1siia1: