Lineage for d1siha3 (1sih A:97-211)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 500605Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 500682Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 500683Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 500684Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 500685Species Arthrobacter globiformis [TaxId:1665] [54421] (14 PDB entries)
  8. 500687Domain d1siha3: 1sih A:97-211 [105577]
    Other proteins in same PDB: d1siha1

Details for d1siha3

PDB Entry: 1sih (more details), 1.73 Å

PDB Description: agao in covalent complex with the inhibitor moba ("4-(4- methylphenoxy)-2-butyn-1-amine")

SCOP Domain Sequences for d1siha3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1siha3 d.17.2.1 (A:97-211) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis}
elpvleeefevveqllatderwlkalaarnldvskvrvaplsagvfeyaeergrrilrgl
afvqdfpedsawahpvdglvayvdvvskevtrvidtgvfpvpaehgnytdpeltg

SCOP Domain Coordinates for d1siha3:

Click to download the PDB-style file with coordinates for d1siha3.
(The format of our PDB-style files is described here.)

Timeline for d1siha3: