![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) ![]() |
![]() | Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins) duplication: contains two domains of this fold |
![]() | Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species) |
![]() | Species Arthrobacter globiformis [TaxId:1665] [54421] (15 PDB entries) |
![]() | Domain d1siha2: 1sih A:9-96 [105576] Other proteins in same PDB: d1siha1 |
PDB Entry: 1sih (more details), 1.73 Å
SCOP Domain Sequences for d1siha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1siha2 d.17.2.1 (A:9-96) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis} aspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrvfihdvs garpqevtvsvtngtvisaveldtaatg
Timeline for d1siha2: