Lineage for d1siha1 (1sih A:212-628)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2781474Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2781475Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
    automatically mapped to Pfam PF01179
  5. 2781476Family b.30.2.1: Amine oxidase catalytic domain [49999] (3 proteins)
  6. 2781477Protein Copper amine oxidase, domain 3 [50000] (4 species)
  7. 2781478Species Arthrobacter globiformis [TaxId:1665] [50003] (41 PDB entries)
    Uniprot P46881 9-628
  8. 2781523Domain d1siha1: 1sih A:212-628 [105575]
    Other proteins in same PDB: d1siha2, d1siha3
    complexed with cu, gol, na, so4

Details for d1siha1

PDB Entry: 1sih (more details), 1.73 Å

PDB Description: agao in covalent complex with the inhibitor moba ("4-(4- methylphenoxy)-2-butyn-1-amine")
PDB Compounds: (A:) phenylethylamine oxidase

SCOPe Domain Sequences for d1siha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1siha1 b.30.2.1 (A:212-628) Copper amine oxidase, domain 3 {Arthrobacter globiformis [TaxId: 1665]}
plrttqkpisitqpegpsftvtggnhiewekwsldvgfdvregvvlhniafrdgdrlrpi
inrasiaemvvpygdpspirswqnyfdtgeylvgqyanslelgcdclgditylspvisda
fgnpreirngicmheedwgilakhsdlwsginytrrnrrmvisffttignydygfywyly
ldgtiefeakatgvvftsafpeggsdnisqlapglgapfhqhifsarldmaidgftnrve
eedvvrqtmgpgnergnafsrkrtvltreseavreadartgrtwiisnpesknrlnepvg
yklhahnqptlladpgssiarraafatkdlwvtryadderyptgdfvnqhsggaglpsyi
aqdrdidgqdivvwhtfglthfprvedwpimpvdtvgfklrpegffdrspvldvpan

SCOPe Domain Coordinates for d1siha1:

Click to download the PDB-style file with coordinates for d1siha1.
(The format of our PDB-style files is described here.)

Timeline for d1siha1: