Lineage for d1si9c_ (1si9 C:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1650675Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 1650744Family d.58.4.4: Plant stress-induced protein [89927] (3 proteins)
    automatically mapped to Pfam PF07876
  6. 1650745Protein Boiling stable protein 1 [110953] (1 species)
  7. 1650746Species European aspen (Populus tremula) [TaxId:113636] [110954] (2 PDB entries)
    Uniprot Q9AR79
  8. 1650773Domain d1si9c_: 1si9 C: [105573]
    complexed with gol

Details for d1si9c_

PDB Entry: 1si9 (more details), 2.27 Å

PDB Description: Boiling stable protein isolated from Populus tremula
PDB Compounds: (C:) stable protein 1

SCOPe Domain Sequences for d1si9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1si9c_ d.58.4.4 (C:) Boiling stable protein 1 {European aspen (Populus tremula) [TaxId: 113636]}
trtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaelnrg
ythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly

SCOPe Domain Coordinates for d1si9c_:

Click to download the PDB-style file with coordinates for d1si9c_.
(The format of our PDB-style files is described here.)

Timeline for d1si9c_: