SCOP 1.71: Domain d1si9c_: 1si9 C:

Lineage for d1si9c_ (1si9 C:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (13 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.4: Plant stress-induced protein [89927] (3 proteins)

6. Protein Boiling stable protein 1 [110953] (1 species)

7. Species European aspen (Populus tremula) [TaxId:113636] [110954] (2 PDB entries)

8. Domain d1si9c_: 1si9 C: [105573]
   complexed with gol

Details for d1si9c_

PDB Entry: 1si9, 2.27 Å

PDB Description: Boiling stable protein isolated from Populus tremula

SCOP Domain Sequences for d1si9c_:

Sequence; same for both SEQRES and ATOM records:

>d1si9c_ d.58.4.4 (C:) Boiling stable protein 1 {European aspen (Populus tremula)}
trtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaelnrg
ythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly

Timeline for d1si9c_:

• d1si9c_ first appeared in SCOP 1.69
  
• d1si9c_ appears in SCOP 1.73
  
• d1si9c_ appears in the current release, SCOPe 2.08