Lineage for d1si9a_ (1si9 A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. Family d.58.4.4: Plant stress-induced protein [89927] (3 proteins)
    automatically mapped to Pfam PF07876
  6. Protein Boiling stable protein 1 [110953] (1 species)
  7. Species European aspen (Populus tremula) [TaxId:113636] [110954] (2 PDB entries)
    Uniprot Q9AR79
  8. Domain d1si9a_: 1si9 A: [105571]
    complexed with gol

Details for d1si9a_

PDB Entry: 1si9 (more details), 2.27 Å

PDB Description: Boiling stable protein isolated from Populus tremula
PDB Compounds: (A:) stable protein 1

SCOPe Domain Sequences for d1si9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1si9a_ d.58.4.4 (A:) Boiling stable protein 1 {European aspen (Populus tremula) [TaxId: 113636]}
trtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaelnrg
ythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly

SCOPe Domain Coordinates for d1si9a_ are not available.

Timeline for d1si9a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1si9b_, d1si9c_