![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.14: PAZ domain [101690] (2 families) ![]() |
![]() | Family b.34.14.1: PAZ domain [101691] (6 proteins) |
![]() | Protein Eukaryotic translation initiation factor 2C 1, EIF2C1 [110165] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [110166] (2 PDB entries) Uniprot Q9UL18 225-349 |
![]() | Domain d1si3a1: 1si3 A:225-349 [105570] Other proteins in same PDB: d1si3a2 complex with a siRNA-like duplex protein/RNA complex |
PDB Entry: 1si3 (more details), 2.6 Å
SCOPe Domain Sequences for d1si3a1:
Sequence, based on SEQRES records: (download)
>d1si3a1 b.34.14.1 (A:225-349) Eukaryotic translation initiation factor 2C 1, EIF2C1 {Human (Homo sapiens) [TaxId: 9606]} aqpviefmcevldirnideqpkpltdsqrvrftkeikglkvevthcgqmkrkyrvcnvtr rpashqtfplqlesgqtvectvaqyfkqkynlqlkyphlpclqvgqeqkhtylplevcni vagqr
>d1si3a1 b.34.14.1 (A:225-349) Eukaryotic translation initiation factor 2C 1, EIF2C1 {Human (Homo sapiens) [TaxId: 9606]} aqpviefmcevldirnideqpkpltdsqrvrftkeikglkvevthcgqmkrkyrvcnvtr rpashqtfplqvectvaqyfkqkynlqlkyphlpclqvgqeqkhtylplevcnivagqr
Timeline for d1si3a1: