SCOPe 2.08: Domain d1si3a1: 1si3 A:225-349

Lineage for d1si3a1 (1si3 A:225-349)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.14: PAZ domain [101690] (2 families)

5. Family b.34.14.1: PAZ domain [101691] (6 proteins)

6. Protein Eukaryotic translation initiation factor 2C 1, EIF2C1 [110165] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110166] (2 PDB entries)
   Uniprot Q9UL18 225-349

8. Domain d1si3a1: 1si3 A:225-349 [105570]
   Other proteins in same PDB: d1si3a2
   complex with a siRNA-like duplex
   protein/RNA complex

Details for d1si3a1

PDB Entry: 1si3, 2.6 Å

PDB Description: Crystal structure of the PAZ domain of human eIF2c1 in complex with a 9-mer siRNA-like duplex

PDB Compounds: (A:) Eukaryotic translation initiation factor 2C 1

SCOPe Domain Sequences for d1si3a1:

Sequence, based on SEQRES records:

>d1si3a1 b.34.14.1 (A:225-349) Eukaryotic translation initiation factor 2C 1, EIF2C1 {Human (Homo sapiens) [TaxId: 9606]}
aqpviefmcevldirnideqpkpltdsqrvrftkeikglkvevthcgqmkrkyrvcnvtr
rpashqtfplqlesgqtvectvaqyfkqkynlqlkyphlpclqvgqeqkhtylplevcni
vagqr

Sequence, based on observed residues (ATOM records):

>d1si3a1 b.34.14.1 (A:225-349) Eukaryotic translation initiation factor 2C 1, EIF2C1 {Human (Homo sapiens) [TaxId: 9606]}
aqpviefmcevldirnideqpkpltdsqrvrftkeikglkvevthcgqmkrkyrvcnvtr
rpashqtfplqvectvaqyfkqkynlqlkyphlpclqvgqeqkhtylplevcnivagqr

Timeline for d1si3a1:

• d1si3a1 first appeared in SCOP 1.69, called d1si3a_
  
• d1si3a1 appears in SCOPe 2.07