Lineage for d1si3a1 (1si3 A:225-349)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045654Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2047718Superfamily b.34.14: PAZ domain [101690] (2 families) (S)
  5. 2047719Family b.34.14.1: PAZ domain [101691] (6 protein domains)
  6. 2047745Protein Eukaryotic translation initiation factor 2C 1, EIF2C1 [110165] (1 species)
  7. 2047746Species Human (Homo sapiens) [TaxId:9606] [110166] (2 PDB entries)
    Uniprot Q9UL18 225-349
  8. 2047748Domain d1si3a1: 1si3 A:225-349 [105570]
    Other proteins in same PDB: d1si3a2
    complex with a siRNA-like duplex
    protein/RNA complex

Details for d1si3a1

PDB Entry: 1si3 (more details), 2.6 Å

PDB Description: Crystal structure of the PAZ domain of human eIF2c1 in complex with a 9-mer siRNA-like duplex
PDB Compounds: (A:) Eukaryotic translation initiation factor 2C 1

SCOPe Domain Sequences for d1si3a1:

Sequence, based on SEQRES records: (download)

>d1si3a1 b.34.14.1 (A:225-349) Eukaryotic translation initiation factor 2C 1, EIF2C1 {Human (Homo sapiens) [TaxId: 9606]}
aqpviefmcevldirnideqpkpltdsqrvrftkeikglkvevthcgqmkrkyrvcnvtr
rpashqtfplqlesgqtvectvaqyfkqkynlqlkyphlpclqvgqeqkhtylplevcni
vagqr

Sequence, based on observed residues (ATOM records): (download)

>d1si3a1 b.34.14.1 (A:225-349) Eukaryotic translation initiation factor 2C 1, EIF2C1 {Human (Homo sapiens) [TaxId: 9606]}
aqpviefmcevldirnideqpkpltdsqrvrftkeikglkvevthcgqmkrkyrvcnvtr
rpashqtfplqvectvaqyfkqkynlqlkyphlpclqvgqeqkhtylplevcnivagqr

SCOPe Domain Coordinates for d1si3a1:

Click to download the PDB-style file with coordinates for d1si3a1.
(The format of our PDB-style files is described here.)

Timeline for d1si3a1: